PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_9206_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 142aa    MW: 16258.9 Da    PI: 10.5221
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_9206_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.61.8e-29959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien   rqvtfskRrng+lKKA+ELSvLCda+v vi+fsstgklye+ss
  Neem_9206_f_4  9 KRIENLNSRQVTFSKRRNGLLKKAKELSVLCDADVGVIVFSSTGKLYEFSS 59
                   79***********************************************96 PP

2K-box52.81.7e-18591223497
          K-box  34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                    + R++ G++L+ L +keLqqLe++L +++ ++++kK+++lleq+++++  e+++  en++Lrk+
  Neem_9206_f_4  59 SSRRMNGKELDGLCFKELQQLENRLSEGIFSVKDKKEQVLLEQLKRSRLLEQKAVLENETLRKQ 122
                    56************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.3E-43160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.688161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-30264IPR002100Transcription factor, MADS-box
CDDcd002651.25E-37260No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-30323IPR002100Transcription factor, MADS-box
PfamPF003197.0E-271057IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.34612133IPR002487Transcription factor, K-box
PRINTSPR004043.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-1159122IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MGRGKIEIKR IENLNSRQVT FSKRRNGLLK KAKELSVLCD ADVGVIVFSS TGKLYEFSSS  60
RRMNGKELDG LCFKELQQLE NRLSEGIFSV KDKKEQVLLE QLKRSRLLEQ KAVLENETLR  120
KQAIIRCSPP QAESAQVRVH LQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17160160Myocyte-specific enhancer factor 2B
1tqe_Q2e-17160160Myocyte-specific enhancer factor 2B
1tqe_R2e-17160160Myocyte-specific enhancer factor 2B
1tqe_S2e-17160160Myocyte-specific enhancer factor 2B
3mu6_A2e-17260159Myocyte-specific enhancer factor 2A
3mu6_B2e-17260159Myocyte-specific enhancer factor 2A
3mu6_C2e-17260159Myocyte-specific enhancer factor 2A
3mu6_D2e-17260159Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015380906.13e-62PREDICTED: agamous-like MADS-box protein AGL18
SwissprotQ388472e-43AGL15_ARATH; Agamous-like MADS-box protein AGL15
TrEMBLA0A067DSV82e-61A0A067DSV8_CITSI; Uncharacterized protein
TrEMBLM5W7B71e-61M5W7B7_PRUPE; Uncharacterized protein (Fragment)
TrEMBLV4SC552e-61V4SC55_9R
STRINGGLYMA02G33040.12e-55(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.19e-45AGAMOUS-like 15